Anti DND1 pAb (ATL-HPA059723)

Atlas Antibodies

SKU: ATL-HPA059723-25

• 

Protein Description: DND microRNA-mediated repression inhibitor 1
Gene Name: DND1
Alternative Gene Name: MGC34750, RBMS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044595: 83%, ENSRNOG00000016894: 83%
Entrez Gene ID: 373863
Uniprot ID: Q8IYX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCQRMKLGSPVFLTKCLGIGPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSA
• Gene Sequence: LCQRMKLGSPVFLTKCLGIGPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSA
• Gene ID - Mouse: ENSMUSG00000044595
• Gene ID - Rat: ENSRNOG00000016894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.