Anti DNAL1 pAb (ATL-HPA053129)

Atlas Antibodies

SKU: ATL-HPA053129-25

• 
• 

Protein Description: dynein, axonemal, light chain 1
Gene Name: DNAL1
Alternative Gene Name: 1700010H15RiK, C14orf168, CILD16, MGC12435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042523: 94%, ENSRNOG00000042333: 94%
Entrez Gene ID: 83544
Uniprot ID: Q4LDG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL
• Gene Sequence: MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL
• Gene ID - Mouse: ENSMUSG00000042523
• Gene ID - Rat: ENSRNOG00000042333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAL1 pAb (ATL-HPA053129) – 2 Found

Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)