Anti DNAJC7 pAb (ATL-HPA052395)

Atlas Antibodies

SKU:
ATL-HPA052395-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 7
Gene Name: DNAJC7
Alternative Gene Name: TPR2, TTC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014195: 99%, ENSRNOG00000017781: 99%
Entrez Gene ID: 7266
Uniprot ID: Q99615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAP
Gene Sequence FCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAP
Gene ID - Mouse ENSMUSG00000014195
Gene ID - Rat ENSRNOG00000017781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC7 pAb (ATL-HPA052395)
Datasheet Anti DNAJC7 pAb (ATL-HPA052395) Datasheet (External Link)
Vendor Page Anti DNAJC7 pAb (ATL-HPA052395) at Atlas Antibodies

Documents & Links for Anti DNAJC7 pAb (ATL-HPA052395)
Datasheet Anti DNAJC7 pAb (ATL-HPA052395) Datasheet (External Link)
Vendor Page Anti DNAJC7 pAb (ATL-HPA052395)