Anti DNAJC21 pAb (ATL-HPA049208)

Atlas Antibodies

SKU:
ATL-HPA049208-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 21
Gene Name: DNAJC21
Alternative Gene Name: DNAJA5, GS3, JJJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044224: 80%, ENSRNOG00000017876: 74%
Entrez Gene ID: 134218
Uniprot ID: Q5F1R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEMEDAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTN
Gene Sequence KNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEMEDAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTN
Gene ID - Mouse ENSMUSG00000044224
Gene ID - Rat ENSRNOG00000017876
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DNAJC21 pAb (ATL-HPA049208)
Datasheet Anti DNAJC21 pAb (ATL-HPA049208) Datasheet (External Link)
Vendor Page Anti DNAJC21 pAb (ATL-HPA049208) at Atlas Antibodies

Documents & Links for Anti DNAJC21 pAb (ATL-HPA049208)
Datasheet Anti DNAJC21 pAb (ATL-HPA049208) Datasheet (External Link)
Vendor Page Anti DNAJC21 pAb (ATL-HPA049208)