Anti DNAJC18 pAb (ATL-HPA060154)

Atlas Antibodies

SKU: ATL-HPA060154-25

• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 18
Gene Name: DNAJC18
Alternative Gene Name: MGC29463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024350: 83%, ENSRNOG00000019995: 81%
Entrez Gene ID: 202052
Uniprot ID: Q9H819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA
• Gene Sequence: TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA
• Gene ID - Mouse: ENSMUSG00000024350
• Gene ID - Rat: ENSRNOG00000019995
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.