Anti DNAJB5 pAb (ATL-HPA050794)

Atlas Antibodies

SKU: ATL-HPA050794-25

• 

Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 5
Gene Name: DNAJB5
Alternative Gene Name: Hsc40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036052: 100%, ENSRNOG00000000130: 100%
Entrez Gene ID: 25822
Uniprot ID: O75953
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
• Gene Sequence: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS
• Gene ID - Mouse: ENSMUSG00000036052
• Gene ID - Rat: ENSRNOG00000000130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.