Anti DNAJB13 pAb (ATL-HPA052465 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052465-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 13
Gene Name: DNAJB13
Alternative Gene Name: RSPH16A, TSARG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030708: 94%, ENSRNOG00000017975: 94%
Entrez Gene ID: 374407
Uniprot ID: P59910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE
• Gene Sequence: DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE
• Gene ID - Mouse: ENSMUSG00000030708
• Gene ID - Rat: ENSRNOG00000017975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAJB13 pAb (ATL-HPA052465 w/enhanced validation) – 2 Found

Thomas, Lucie; Bouhouche, Khaled; Whitfield, Marjorie; Thouvenin, Guillaume; Coste, Andre; Louis, Bruno; Szymanski, Claire; Bequignon, Emilie; Papon, Jean-François; Castelli, Manon; Lemullois, Michel; Dhalluin, Xavier; Drouin-Garraud, Valérie; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Dastot, Florence; Couvet, Sandrine; Barbotin, Anne-Laure; Faucon, Catherine; Honore, Isabelle; Maitre, Bernard; Beydon, Nicole; Tamalet, Aline; Rives, Nathalie; Koll, France; Escudier, Estelle; Tassin, Anne-Marie; Touré, Aminata; Mitchell, Valérie; Amselem, Serge; Legendre, Marie. TTC12 Loss-of-Function Mutations Cause Primary Ciliary Dyskinesia and Unveil Distinct Dynein Assembly Mechanisms in Motile Cilia Versus Flagella. American Journal Of Human Genetics. 2020;106(2):153-169. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)