Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 1
Gene Name: DNAJB1
Alternative Gene Name: Hsp40, HSPF1, RSPH16B, Sis1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005483: 92%, ENSRNOG00000021824: 93%
Entrez Gene ID: 3337
Uniprot ID: P25685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNAJB1
Alternative Gene Name: Hsp40, HSPF1, RSPH16B, Sis1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005483: 92%, ENSRNOG00000021824: 93%
Entrez Gene ID: 3337
Uniprot ID: P25685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL |
| Documents & Links for Anti DNAJB1 pAb (ATL-HPA063247) | |
| Datasheet | Anti DNAJB1 pAb (ATL-HPA063247) Datasheet (External Link) |
| Vendor Page | Anti DNAJB1 pAb (ATL-HPA063247) at Atlas |
| Documents & Links for Anti DNAJB1 pAb (ATL-HPA063247) | |
| Datasheet | Anti DNAJB1 pAb (ATL-HPA063247) Datasheet (External Link) |
| Vendor Page | Anti DNAJB1 pAb (ATL-HPA063247) |