Anti DNAJB1 pAb (ATL-HPA063247)

Atlas Antibodies

SKU: ATL-HPA063247-25

• 
• 

Protein Description: DnaJ (Hsp40) homolog, subfamily B, member 1
Gene Name: DNAJB1
Alternative Gene Name: Hsp40, HSPF1, RSPH16B, Sis1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005483: 92%, ENSRNOG00000021824: 93%
Entrez Gene ID: 3337
Uniprot ID: P25685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL
• Gene Sequence: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL
• Gene ID - Mouse: ENSMUSG00000005483
• Gene ID - Rat: ENSRNOG00000021824
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.