Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052641-25

• 

Protein Description: dynein, axonemal, heavy chain 9
Gene Name: DNAH9
Alternative Gene Name: DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056752: 80%, ENSRNOG00000004171: 77%
Entrez Gene ID: 1770
Uniprot ID: Q9NYC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL
• Gene Sequence: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL
• Gene ID - Mouse: ENSMUSG00000056752
• Gene ID - Rat: ENSRNOG00000004171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAH9 pAb (ATL-HPA052641 w/enhanced validation) – 3 Found

Loges, Niki T; Antony, Dinu; Maver, Ales; Deardorff, Matthew A; Güleç, Elif Yýlmaz; Gezdirici, Alper; Nöthe-Menchen, Tabea; Höben, Inga M; Jelten, Lena; Frank, Diana; Werner, Claudius; Tebbe, Johannes; Wu, Kaman; Goldmuntz, Elizabeth; Čuturilo, Goran; Krock, Bryan; Ritter, Alyssa; Hjeij, Rim; Bakey, Zeineb; Pennekamp, Petra; Dworniczak, Bernd; Brunner, Han; Peterlin, Borut; Tanidir, Cansaran; Olbrich, Heike; Omran, Heymut; Schmidts, Miriam. Recessive DNAH9 Loss-of-Function Mutations Cause Laterality Defects and Subtle Respiratory Ciliary-Beating Defects. American Journal Of Human Genetics. 2018;103(6):995-1008. 

Whitfield, Marjorie; Thomas, Lucie; Bequignon, Emilie; Schmitt, Alain; Stouvenel, Laurence; Montantin, Guy; Tissier, Sylvie; Duquesnoy, Philippe; Copin, Bruno; Chantot, Sandra; Dastot, Florence; Faucon, Catherine; Barbotin, Anne Laure; Loyens, Anne; Siffroi, Jean-Pierre; Papon, Jean-François; Escudier, Estelle; Amselem, Serge; Mitchell, Valérie; Touré, Aminata; Legendre, Marie. Mutations in DNAH17, Encoding a Sperm-Specific Axonemal Outer Dynein Arm Heavy Chain, Cause Isolated Male Infertility Due to Asthenozoospermia. American Journal Of Human Genetics. 2019;105(1):198-212. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)