Anti DNAH12 pAb (ATL-HPA061365 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061365-25

• 

Product Description

Protein Description: dynein, axonemal, heavy chain 12
Gene Name: DNAH12
Alternative Gene Name: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021879: 88%, ENSRNOG00000059865: 88%
Entrez Gene ID: 201625
Uniprot ID: Q6ZR08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHP
• Gene Sequence: LLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHP
• Gene ID - Mouse: ENSMUSG00000021879
• Gene ID - Rat: ENSRNOG00000059865
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links