Anti DNAH11 pAb (ATL-HPA056474)
Atlas Antibodies
- SKU:
- ATL-HPA056474-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DNAH11
Alternative Gene Name: CILD7, DNAHBL, Dnahc11, DNHBL, DPL11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018581: 72%, ENSRNOG00000005451: 71%
Entrez Gene ID: 8701
Uniprot ID: Q96DT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI |
| Gene Sequence | DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI |
| Gene ID - Mouse | ENSMUSG00000018581 |
| Gene ID - Rat | ENSRNOG00000005451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DNAH11 pAb (ATL-HPA056474) | |
| Datasheet | Anti DNAH11 pAb (ATL-HPA056474) Datasheet (External Link) |
| Vendor Page | Anti DNAH11 pAb (ATL-HPA056474) at Atlas Antibodies |
| Documents & Links for Anti DNAH11 pAb (ATL-HPA056474) | |
| Datasheet | Anti DNAH11 pAb (ATL-HPA056474) Datasheet (External Link) |
| Vendor Page | Anti DNAH11 pAb (ATL-HPA056474) |
| Citations for Anti DNAH11 pAb (ATL-HPA056474) – 1 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |