Protein Description: dynein axonemal assembly factor 1
Gene Name: DNAAF1
Alternative Gene Name: CILD13, FLJ25330, LRRC50, ODA7, swt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031831: 59%, ENSRNOG00000015590: 57%
Entrez Gene ID: 123872
Uniprot ID: Q8NEP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNAAF1
Alternative Gene Name: CILD13, FLJ25330, LRRC50, ODA7, swt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031831: 59%, ENSRNOG00000015590: 57%
Entrez Gene ID: 123872
Uniprot ID: Q8NEP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK |
| Documents & Links for Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) | |
| Datasheet | Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) at Atlas |
| Documents & Links for Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) | |
| Datasheet | Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DNAAF1 pAb (ATL-HPA074239 w/enhanced validation) |