Anti DMRTC2 pAb (ATL-HPA045016)

Atlas Antibodies

SKU:
ATL-HPA045016-25
  • Immunohistochemical staining of human testis shows moderate nucleolar positivity in cells in seminiferus ducts and Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DMRT-like family C2
Gene Name: DMRTC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011349: 81%, ENSRNOG00000046142: 81%
Entrez Gene ID: 63946
Uniprot ID: Q8IXT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWVPGHWLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLSGEPQGPPSQPRTHSTLILQP
Gene Sequence PWVPGHWLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLSGEPQGPPSQPRTHSTLILQP
Gene ID - Mouse ENSMUSG00000011349
Gene ID - Rat ENSRNOG00000046142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DMRTC2 pAb (ATL-HPA045016)
Datasheet Anti DMRTC2 pAb (ATL-HPA045016) Datasheet (External Link)
Vendor Page Anti DMRTC2 pAb (ATL-HPA045016) at Atlas Antibodies

Documents & Links for Anti DMRTC2 pAb (ATL-HPA045016)
Datasheet Anti DMRTC2 pAb (ATL-HPA045016) Datasheet (External Link)
Vendor Page Anti DMRTC2 pAb (ATL-HPA045016)