Anti DLGAP4 pAb (ATL-HPA054105)

Atlas Antibodies

SKU: ATL-HPA054105-25

• 
• 

Protein Description: discs, large (Drosophila) homolog-associated protein 4
Gene Name: DLGAP4
Alternative Gene Name: DAP4, KIAA0964, SAPAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061689: 96%, ENSRNOG00000020225: 98%
Entrez Gene ID: 22839
Uniprot ID: Q9Y2H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL
• Gene Sequence: GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL
• Gene ID - Mouse: ENSMUSG00000061689
• Gene ID - Rat: ENSRNOG00000020225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DLGAP4 pAb (ATL-HPA054105) – 1 Found

Schob, Claudia; Morellini, Fabio; Ohana, Ora; Bakota, Lidia; Hrynchak, Mariya V; Brandt, Roland; Brockmann, Marco D; Cichon, Nicole; Hartung, Henrike; Hanganu-Opatz, Ileana L; Kraus, Vanessa; Scharf, Sarah; Herrmans-Borgmeyer, Irm; Schweizer, Michaela; Kuhl, Dietmar; Wöhr, Markus; Vörckel, Karl J; Calzada-Wack, Julia; Fuchs, Helmut; Gailus-Durner, Valérie; Hrabě de Angelis, Martin; Garner, Craig C; Kreienkamp, Hans-Jürgen; Kindler, Stefan. Cognitive impairment and autistic-like behaviour in SAPAP4-deficient mice. Translational Psychiatry. 2019;9(1):7.