Anti DLEU7 pAb (ATL-HPA053750)

Atlas Antibodies

SKU:
ATL-HPA053750-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: deleted in lymphocytic leukemia, 7
Gene Name: DLEU7
Alternative Gene Name: FLJ44882
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048281: 96%, ENSRNOG00000009181: 97%
Entrez Gene ID: 220107
Uniprot ID: Q6UYE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFP
Gene Sequence VVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFP
Gene ID - Mouse ENSMUSG00000048281
Gene ID - Rat ENSRNOG00000009181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DLEU7 pAb (ATL-HPA053750)
Datasheet Anti DLEU7 pAb (ATL-HPA053750) Datasheet (External Link)
Vendor Page Anti DLEU7 pAb (ATL-HPA053750) at Atlas Antibodies

Documents & Links for Anti DLEU7 pAb (ATL-HPA053750)
Datasheet Anti DLEU7 pAb (ATL-HPA053750) Datasheet (External Link)
Vendor Page Anti DLEU7 pAb (ATL-HPA053750)