Anti DKK4 pAb (ATL-HPA052916 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052916-100

• 
• 

Protein Description: dickkopf WNT signaling pathway inhibitor 4
Gene Name: DKK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031535: 70%, ENSRNOG00000019267: 71%
Entrez Gene ID: 27121
Uniprot ID: Q9UBT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH
• Gene Sequence: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH
• Gene ID - Mouse: ENSMUSG00000031535
• Gene ID - Rat: ENSRNOG00000019267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.