Anti DKK2 pAb (ATL-HPA052611)

Atlas Antibodies

SKU:
ATL-HPA052611-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dickkopf WNT signaling pathway inhibitor 2
Gene Name: DKK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028031: 95%, ENSRNOG00000011360: 95%
Entrez Gene ID: 27123
Uniprot ID: Q9UBU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC
Gene Sequence MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC
Gene ID - Mouse ENSMUSG00000028031
Gene ID - Rat ENSRNOG00000011360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DKK2 pAb (ATL-HPA052611)
Datasheet Anti DKK2 pAb (ATL-HPA052611) Datasheet (External Link)
Vendor Page Anti DKK2 pAb (ATL-HPA052611) at Atlas Antibodies

Documents & Links for Anti DKK2 pAb (ATL-HPA052611)
Datasheet Anti DKK2 pAb (ATL-HPA052611) Datasheet (External Link)
Vendor Page Anti DKK2 pAb (ATL-HPA052611)