Anti DISP3 pAb (ATL-HPA054579)

Atlas Antibodies

SKU: ATL-HPA054579-25

• 

Protein Description: dispatched RND transporter family member 3
Gene Name: DISP3
Alternative Gene Name: KIAA1337, PTCHD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041544: 97%, ENSRNOG00000026447: 97%
Entrez Gene ID: 57540
Uniprot ID: Q9P2K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSGYSISSFLQMLHPECKELPEPNLLPGQLSHGAVGVREGRVQWISMAFESTTYKGKSSFQTYSDYLRWESFLQQQ
• Gene Sequence: PSGYSISSFLQMLHPECKELPEPNLLPGQLSHGAVGVREGRVQWISMAFESTTYKGKSSFQTYSDYLRWESFLQQQ
• Gene ID - Mouse: ENSMUSG00000041544
• Gene ID - Rat: ENSRNOG00000026447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.