Anti DIP2C pAb (ATL-HPA059325)

Atlas Antibodies

SKU: ATL-HPA059325-25

• 
• 

Protein Description: disco-interacting protein 2 homolog C
Gene Name: DIP2C
Alternative Gene Name: KIAA0934
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048264: 100%, ENSRNOG00000015288: 68%
Entrez Gene ID: 22982
Uniprot ID: Q9Y2E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERY
• Gene Sequence: KKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERY
• Gene ID - Mouse: ENSMUSG00000048264
• Gene ID - Rat: ENSRNOG00000015288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.