Anti DIP2B pAb (ATL-HPA046133)

Atlas Antibodies

SKU:
ATL-HPA046133-25
  • Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DIP2 disco-interacting protein 2 homolog B (Drosophila)
Gene Name: DIP2B
Alternative Gene Name: FLJ34278, KIAA1463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023026: 91%, ENSRNOG00000056106: 91%
Entrez Gene ID: 57609
Uniprot ID: Q9P265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
Gene Sequence EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
Gene ID - Mouse ENSMUSG00000023026
Gene ID - Rat ENSRNOG00000056106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DIP2B pAb (ATL-HPA046133)
Datasheet Anti DIP2B pAb (ATL-HPA046133) Datasheet (External Link)
Vendor Page Anti DIP2B pAb (ATL-HPA046133) at Atlas Antibodies

Documents & Links for Anti DIP2B pAb (ATL-HPA046133)
Datasheet Anti DIP2B pAb (ATL-HPA046133) Datasheet (External Link)
Vendor Page Anti DIP2B pAb (ATL-HPA046133)



Citations for Anti DIP2B pAb (ATL-HPA046133) – 1 Found
Xing, Zhen-Kai; Zhang, Lu-Qing; Zhang, Yu; Sun, Xue; Sun, Xiao-Lin; Yu, Hua-Li; Zheng, Yao-Wu; He, Zi-Xuan; Zhu, Xiao-Juan. DIP2B Interacts With α-Tubulin to Regulate Axon Outgrowth. Frontiers In Cellular Neuroscience. 14( 32153366):29.  PubMed