Anti DIP2A pAb (ATL-HPA052516)

Atlas Antibodies

SKU: ATL-HPA052516-25

• 
• 

Protein Description: DIP2 disco-interacting protein 2 homolog A (Drosophila)
Gene Name: DIP2A
Alternative Gene Name: C21orf106, Dip2, KIAA0184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020231: 79%, ENSRNOG00000043212: 63%
Entrez Gene ID: 23181
Uniprot ID: Q14689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
• Gene Sequence: RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
• Gene ID - Mouse: ENSMUSG00000020231
• Gene ID - Rat: ENSRNOG00000043212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.