Protein Description: iodothyronine deiodinase 3
Gene Name: DIO3
Alternative Gene Name: TXDI3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075707: 90%, ENSRNOG00000058068: 29%
Entrez Gene ID: 1735
Uniprot ID: P55073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DIO3
Alternative Gene Name: TXDI3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075707: 90%, ENSRNOG00000058068: 29%
Entrez Gene ID: 1735
Uniprot ID: P55073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFF |
| Documents & Links for Anti DIO3 pAb (ATL-HPA073684) | |
| Datasheet | Anti DIO3 pAb (ATL-HPA073684) Datasheet (External Link) |
| Vendor Page | Anti DIO3 pAb (ATL-HPA073684) at Atlas |
| Documents & Links for Anti DIO3 pAb (ATL-HPA073684) | |
| Datasheet | Anti DIO3 pAb (ATL-HPA073684) Datasheet (External Link) |
| Vendor Page | Anti DIO3 pAb (ATL-HPA073684) |