Anti DIO2 pAb (ATL-HPA048002)

Atlas Antibodies

SKU:
ATL-HPA048002-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: deiodinase, iodothyronine, type II
Gene Name: DIO2
Alternative Gene Name: SelY, TXDI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007682: 80%, ENSRNOG00000057724: 51%
Entrez Gene ID: 1734
Uniprot ID: Q92813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP
Gene Sequence EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP
Gene ID - Mouse ENSMUSG00000007682
Gene ID - Rat ENSRNOG00000057724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DIO2 pAb (ATL-HPA048002)
Datasheet Anti DIO2 pAb (ATL-HPA048002) Datasheet (External Link)
Vendor Page Anti DIO2 pAb (ATL-HPA048002) at Atlas Antibodies

Documents & Links for Anti DIO2 pAb (ATL-HPA048002)
Datasheet Anti DIO2 pAb (ATL-HPA048002) Datasheet (External Link)
Vendor Page Anti DIO2 pAb (ATL-HPA048002)