Anti DHX9 pAb (ATL-HPA055684)

Atlas Antibodies

SKU:
ATL-HPA055684-25
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 9
Gene Name: DHX9
Alternative Gene Name: DDX9, LKP, RHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042699: 88%, ENSRNOG00000002735: 88%
Entrez Gene ID: 1660
Uniprot ID: Q08211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ
Gene Sequence TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ
Gene ID - Mouse ENSMUSG00000042699
Gene ID - Rat ENSRNOG00000002735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX9 pAb (ATL-HPA055684)
Datasheet Anti DHX9 pAb (ATL-HPA055684) Datasheet (External Link)
Vendor Page Anti DHX9 pAb (ATL-HPA055684) at Atlas Antibodies

Documents & Links for Anti DHX9 pAb (ATL-HPA055684)
Datasheet Anti DHX9 pAb (ATL-HPA055684) Datasheet (External Link)
Vendor Page Anti DHX9 pAb (ATL-HPA055684)