Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049285-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & nuclear bodies.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DHX8 antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 8
Gene Name: DHX8
Alternative Gene Name: DDX8, HRH1, PRP22, PRPF22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034931: 100%, ENSRNOG00000020772: 100%
Entrez Gene ID: 1659
Uniprot ID: Q14562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP
Gene Sequence PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP
Gene ID - Mouse ENSMUSG00000034931
Gene ID - Rat ENSRNOG00000020772
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation)
Datasheet Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation)
Datasheet Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DHX8 pAb (ATL-HPA049285 w/enhanced validation)