Anti DHX15 pAb (ATL-HPA047047)

Atlas Antibodies

SKU: ATL-HPA047047-25

• 
• 
• 

Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 15
Gene Name: DHX15
Alternative Gene Name: DBP1, DDX15, HRH2, PRP43, PRPF43, PrPp43p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029169: 98%, ENSRNOG00000003844: 99%
Entrez Gene ID: 1665
Uniprot ID: O43143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD
• Gene Sequence: RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD
• Gene ID - Mouse: ENSMUSG00000029169
• Gene ID - Rat: ENSRNOG00000003844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DHX15 pAb (ATL-HPA047047) – 1 Found

Zhang, Sunyuan; Hinde, Elizabeth; Parkyn Schneider, Molly; Jans, David A; Bogoyevitch, Marie A. Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics. Scientific Reports. 2020;10(1):1557.