Protein Description: dehydrogenase/reductase X-linked
Gene Name: DHRSX
Alternative Gene Name: DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063897: 60%, ENSRNOG00000028323: 44%
Entrez Gene ID: 207063
Uniprot ID: Q8N5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DHRSX
Alternative Gene Name: DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063897: 60%, ENSRNOG00000028323: 44%
Entrez Gene ID: 207063
Uniprot ID: Q8N5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLAL |
| Documents & Links for Anti DHRSX pAb (ATL-HPA075955) | |
| Datasheet | Anti DHRSX pAb (ATL-HPA075955) Datasheet (External Link) |
| Vendor Page | Anti DHRSX pAb (ATL-HPA075955) at Atlas |
| Documents & Links for Anti DHRSX pAb (ATL-HPA075955) | |
| Datasheet | Anti DHRSX pAb (ATL-HPA075955) Datasheet (External Link) |
| Vendor Page | Anti DHRSX pAb (ATL-HPA075955) |