Anti DHRS11 pAb (ATL-HPA053623 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053623-25

• 

Protein Description: dehydrogenase/reductase (SDR family) member 11
Gene Name: DHRS11
Alternative Gene Name: MGC4172, SDR24C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034449: 97%, ENSRNOG00000027891: 97%
Entrez Gene ID: 79154
Uniprot ID: Q6UWP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
• Gene Sequence: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
• Gene ID - Mouse: ENSMUSG00000034449
• Gene ID - Rat: ENSRNOG00000027891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.