Protein Description: dehydrogenase/reductase 1
Gene Name: DHRS1
Alternative Gene Name: FLJ25430, MGC20204, SDR19C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002332: 93%, ENSRNOG00000020264: 93%
Entrez Gene ID: 115817
Uniprot ID: Q96LJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DHRS1
Alternative Gene Name: FLJ25430, MGC20204, SDR19C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002332: 93%, ENSRNOG00000020264: 93%
Entrez Gene ID: 115817
Uniprot ID: Q96LJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDV |
Gene ID - Mouse | ENSMUSG00000002332 |
Gene ID - Rat | ENSMUSG00000002332 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DHRS1 pAb (ATL-HPA076886) | |
Datasheet | Anti DHRS1 pAb (ATL-HPA076886) Datasheet (External Link) |
Vendor Page | Anti DHRS1 pAb (ATL-HPA076886) at Atlas |
Documents & Links for Anti DHRS1 pAb (ATL-HPA076886) | |
Datasheet | Anti DHRS1 pAb (ATL-HPA076886) Datasheet (External Link) |
Vendor Page | Anti DHRS1 pAb (ATL-HPA076886) |