Anti DGKZ pAb (ATL-HPA051336)

Atlas Antibodies

SKU:
ATL-HPA051336-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
  • Western blot analysis in human cell line SCLC-21H.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, zeta
Gene Name: DGKZ
Alternative Gene Name: DAGK5, DAGK6, DGK-ZETA, hDGKzeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040479: 92%, ENSRNOG00000017737: 96%
Entrez Gene ID: 8525
Uniprot ID: Q13574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE
Gene Sequence EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE
Gene ID - Mouse ENSMUSG00000040479
Gene ID - Rat ENSRNOG00000017737
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DGKZ pAb (ATL-HPA051336)
Datasheet Anti DGKZ pAb (ATL-HPA051336) Datasheet (External Link)
Vendor Page Anti DGKZ pAb (ATL-HPA051336) at Atlas Antibodies

Documents & Links for Anti DGKZ pAb (ATL-HPA051336)
Datasheet Anti DGKZ pAb (ATL-HPA051336) Datasheet (External Link)
Vendor Page Anti DGKZ pAb (ATL-HPA051336)