Anti DGKD pAb (ATL-HPA049101)

Atlas Antibodies

SKU:
ATL-HPA049101-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular and myoepithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, delta 130kDa
Gene Name: DGKD
Alternative Gene Name: DGKdelta, KIAA0145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070738: 82%, ENSRNOG00000023238: 82%
Entrez Gene ID: 8527
Uniprot ID: Q16760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS
Gene Sequence TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS
Gene ID - Mouse ENSMUSG00000070738
Gene ID - Rat ENSRNOG00000023238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DGKD pAb (ATL-HPA049101)
Datasheet Anti DGKD pAb (ATL-HPA049101) Datasheet (External Link)
Vendor Page Anti DGKD pAb (ATL-HPA049101) at Atlas Antibodies

Documents & Links for Anti DGKD pAb (ATL-HPA049101)
Datasheet Anti DGKD pAb (ATL-HPA049101) Datasheet (External Link)
Vendor Page Anti DGKD pAb (ATL-HPA049101)



Citations for Anti DGKD pAb (ATL-HPA049101) – 1 Found
Day, Priscilla; Burrows, Lisa; Richards, David; Fountain, Samuel J. Inhibitors of DAG metabolism suppress CCR2 signalling in human monocytes. British Journal Of Pharmacology. 2019;176(15):2736-2749.  PubMed