Anti DGKD pAb (ATL-HPA049101)
Atlas Antibodies
- SKU:
- ATL-HPA049101-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DGKD
Alternative Gene Name: DGKdelta, KIAA0145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070738: 82%, ENSRNOG00000023238: 82%
Entrez Gene ID: 8527
Uniprot ID: Q16760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS |
Gene Sequence | TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS |
Gene ID - Mouse | ENSMUSG00000070738 |
Gene ID - Rat | ENSRNOG00000023238 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DGKD pAb (ATL-HPA049101) | |
Datasheet | Anti DGKD pAb (ATL-HPA049101) Datasheet (External Link) |
Vendor Page | Anti DGKD pAb (ATL-HPA049101) at Atlas Antibodies |
Documents & Links for Anti DGKD pAb (ATL-HPA049101) | |
Datasheet | Anti DGKD pAb (ATL-HPA049101) Datasheet (External Link) |
Vendor Page | Anti DGKD pAb (ATL-HPA049101) |
Citations for Anti DGKD pAb (ATL-HPA049101) – 1 Found |
Day, Priscilla; Burrows, Lisa; Richards, David; Fountain, Samuel J. Inhibitors of DAG metabolism suppress CCR2 signalling in human monocytes. British Journal Of Pharmacology. 2019;176(15):2736-2749. PubMed |