Anti DFFB pAb (ATL-HPA052904)

Atlas Antibodies

SKU: ATL-HPA052904-25

• 

Protein Description: DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
Gene Name: DFFB
Alternative Gene Name: CAD, CPAN, DFF-40, DFF40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029027: 84%, ENSRNOG00000025030: 81%
Entrez Gene ID: 1677
Uniprot ID: O76075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
• Gene Sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
• Gene ID - Mouse: ENSMUSG00000029027
• Gene ID - Rat: ENSRNOG00000025030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.