Anti DET1 pAb (ATL-HPA048873)

Atlas Antibodies

SKU:
ATL-HPA048873-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & microtubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: de-etiolated homolog 1 (Arabidopsis)
Gene Name: DET1
Alternative Gene Name: FLJ10103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030610: 99%, ENSRNOG00000018515: 99%
Entrez Gene ID: 55070
Uniprot ID: Q7L5Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECS
Gene Sequence THWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECS
Gene ID - Mouse ENSMUSG00000030610
Gene ID - Rat ENSRNOG00000018515
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DET1 pAb (ATL-HPA048873)
Datasheet Anti DET1 pAb (ATL-HPA048873) Datasheet (External Link)
Vendor Page Anti DET1 pAb (ATL-HPA048873) at Atlas Antibodies

Documents & Links for Anti DET1 pAb (ATL-HPA048873)
Datasheet Anti DET1 pAb (ATL-HPA048873) Datasheet (External Link)
Vendor Page Anti DET1 pAb (ATL-HPA048873)