Anti DESI1 pAb (ATL-HPA053415)

Atlas Antibodies

SKU: ATL-HPA053415-25

• 
• 

Protein Description: desumoylating isopeptidase 1
Gene Name: DESI1
Alternative Gene Name: D15Wsu75e, FAM152B, PPPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022472: 95%, ENSRNOG00000005577: 95%
Entrez Gene ID: 27351
Uniprot ID: Q6ICB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
• Gene Sequence: IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
• Gene ID - Mouse: ENSMUSG00000022472
• Gene ID - Rat: ENSRNOG00000005577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.