Anti DENND5A pAb (ATL-HPA055009)

Atlas Antibodies

SKU: ATL-HPA055009-25

• 

Protein Description: DENN/MADD domain containing 5A
Gene Name: DENND5A
Alternative Gene Name: FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035901: 92%, ENSRNOG00000012206: 91%
Entrez Gene ID: 23258
Uniprot ID: Q6IQ26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALWSHLLHYQDNRQRKLTSGSLSTSGILLDSERRKSDASSLMPPLRISLIQD
• Gene Sequence: SALWSHLLHYQDNRQRKLTSGSLSTSGILLDSERRKSDASSLMPPLRISLIQD
• Gene ID - Mouse: ENSMUSG00000035901
• Gene ID - Rat: ENSRNOG00000012206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.