Anti DENND2C pAb (ATL-HPA054955)

Atlas Antibodies

SKU:
ATL-HPA054955-25
  • Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 2C
Gene Name: DENND2C
Alternative Gene Name: dJ1156J9.1, DKFZp686G0351, DKFZp779P1149, FLJ37099, RP5-1156J9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007379: 44%, ENSRNOG00000018716: 47%
Entrez Gene ID: 163259
Uniprot ID: Q68D51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKNLDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKED
Gene Sequence WEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKNLDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKED
Gene ID - Mouse ENSMUSG00000007379
Gene ID - Rat ENSRNOG00000018716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DENND2C pAb (ATL-HPA054955)
Datasheet Anti DENND2C pAb (ATL-HPA054955) Datasheet (External Link)
Vendor Page Anti DENND2C pAb (ATL-HPA054955) at Atlas Antibodies

Documents & Links for Anti DENND2C pAb (ATL-HPA054955)
Datasheet Anti DENND2C pAb (ATL-HPA054955) Datasheet (External Link)
Vendor Page Anti DENND2C pAb (ATL-HPA054955)