Anti DEFB124 pAb (ATL-HPA051046)
Atlas Antibodies
- SKU:
- ATL-HPA051046-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEFB124
Alternative Gene Name: DEFB-24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074678: 69%, ENSRNOG00000036895: 69%
Entrez Gene ID: 245937
Uniprot ID: Q8NES8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE |
Gene Sequence | FKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE |
Gene ID - Mouse | ENSMUSG00000074678 |
Gene ID - Rat | ENSRNOG00000036895 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEFB124 pAb (ATL-HPA051046) | |
Datasheet | Anti DEFB124 pAb (ATL-HPA051046) Datasheet (External Link) |
Vendor Page | Anti DEFB124 pAb (ATL-HPA051046) at Atlas Antibodies |
Documents & Links for Anti DEFB124 pAb (ATL-HPA051046) | |
Datasheet | Anti DEFB124 pAb (ATL-HPA051046) Datasheet (External Link) |
Vendor Page | Anti DEFB124 pAb (ATL-HPA051046) |