Anti DEFB116 pAb (ATL-HPA047430)
Atlas Antibodies
- SKU:
- ATL-HPA047430-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEFB116
Alternative Gene Name: DEFB-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044249: 44%, ENSRNOG00000023195: 47%
Entrez Gene ID: 245930
Uniprot ID: Q30KQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY |
Gene Sequence | SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY |
Gene ID - Mouse | ENSMUSG00000044249 |
Gene ID - Rat | ENSRNOG00000023195 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEFB116 pAb (ATL-HPA047430) | |
Datasheet | Anti DEFB116 pAb (ATL-HPA047430) Datasheet (External Link) |
Vendor Page | Anti DEFB116 pAb (ATL-HPA047430) at Atlas Antibodies |
Documents & Links for Anti DEFB116 pAb (ATL-HPA047430) | |
Datasheet | Anti DEFB116 pAb (ATL-HPA047430) Datasheet (External Link) |
Vendor Page | Anti DEFB116 pAb (ATL-HPA047430) |