Anti DEFB107A pAb (ATL-HPA045626)

Atlas Antibodies

SKU:
ATL-HPA045626-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: defensin, beta 107A
Gene Name: DEFB107A
Alternative Gene Name: DEFB-7, DEFB107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044222: 44%, ENSRNOG00000038157: 49%
Entrez Gene ID: 245910
Uniprot ID: Q8IZN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Gene Sequence QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Gene ID - Mouse ENSMUSG00000044222
Gene ID - Rat ENSRNOG00000038157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEFB107A pAb (ATL-HPA045626)
Datasheet Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link)
Vendor Page Anti DEFB107A pAb (ATL-HPA045626) at Atlas Antibodies

Documents & Links for Anti DEFB107A pAb (ATL-HPA045626)
Datasheet Anti DEFB107A pAb (ATL-HPA045626) Datasheet (External Link)
Vendor Page Anti DEFB107A pAb (ATL-HPA045626)