Anti DDX60L pAb (ATL-HPA055501)

Atlas Antibodies

SKU:
ATL-HPA055501-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like
Gene Name: DDX60L
Alternative Gene Name: FLJ31033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037921: 51%, ENSRNOG00000059097: 49%
Entrez Gene ID: 91351
Uniprot ID: Q5H9U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKWNDMMEEAYQTLFLLQHLWSEGSDIQR
Gene Sequence YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKWNDMMEEAYQTLFLLQHLWSEGSDIQR
Gene ID - Mouse ENSMUSG00000037921
Gene ID - Rat ENSRNOG00000059097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX60L pAb (ATL-HPA055501)
Datasheet Anti DDX60L pAb (ATL-HPA055501) Datasheet (External Link)
Vendor Page Anti DDX60L pAb (ATL-HPA055501) at Atlas Antibodies

Documents & Links for Anti DDX60L pAb (ATL-HPA055501)
Datasheet Anti DDX60L pAb (ATL-HPA055501) Datasheet (External Link)
Vendor Page Anti DDX60L pAb (ATL-HPA055501)