Anti DDX60 pAb (ATL-HPA046952)

Atlas Antibodies

SKU: ATL-HPA046952-25

• 
• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Gene Name: DDX60
Alternative Gene Name: FLJ20035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037921: 67%, ENSRNOG00000059097: 73%
Entrez Gene ID: 55601
Uniprot ID: Q8IY21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
• Gene Sequence: PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
• Gene ID - Mouse: ENSMUSG00000037921
• Gene ID - Rat: ENSRNOG00000059097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DDX60 pAb (ATL-HPA046952) – 1 Found

Geng, Nina; Hu, Tuo; He, Chunbo. Identification of DDX60 as a Regulator of MHC-I Class Molecules in Colorectal Cancer. Biomedicines. 2022;10(12)