Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047166-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in actin filaments.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DDX59 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422174).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 59
Gene Name: DDX59
Alternative Gene Name: DKFZP564B1023, ZNHIT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026404: 85%, ENSRNOG00000042451: 81%
Entrez Gene ID: 83479
Uniprot ID: Q5T1V6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
Gene Sequence VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
Gene ID - Mouse ENSMUSG00000026404
Gene ID - Rat ENSRNOG00000042451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation)
Datasheet Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation)
Datasheet Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation)