Anti DDX58 pAb (ATL-HPA047193)

Atlas Antibodies

SKU: ATL-HPA047193-25

• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
Gene Name: DDX58
Alternative Gene Name: DKFZp434J1111, FLJ13599, RIG-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040296: 80%, ENSRNOG00000006384: 58%
Entrez Gene ID: 23586
Uniprot ID: O95786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
• Gene Sequence: NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
• Gene ID - Mouse: ENSMUSG00000040296
• Gene ID - Rat: ENSRNOG00000006384
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.