Anti DDX52 pAb (ATL-HPA056173)

Atlas Antibodies

SKU:
ATL-HPA056173-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 52
Gene Name: DDX52
Alternative Gene Name: ROK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020677: 65%, ENSRNOG00000002612: 60%
Entrez Gene ID: 11056
Uniprot ID: Q9Y2R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS
Gene Sequence KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS
Gene ID - Mouse ENSMUSG00000020677
Gene ID - Rat ENSRNOG00000002612
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX52 pAb (ATL-HPA056173)
Datasheet Anti DDX52 pAb (ATL-HPA056173) Datasheet (External Link)
Vendor Page Anti DDX52 pAb (ATL-HPA056173) at Atlas Antibodies

Documents & Links for Anti DDX52 pAb (ATL-HPA056173)
Datasheet Anti DDX52 pAb (ATL-HPA056173) Datasheet (External Link)
Vendor Page Anti DDX52 pAb (ATL-HPA056173)