Anti DDX49 pAb (ATL-HPA048093)

Atlas Antibodies

SKU:
ATL-HPA048093-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
Gene Name: DDX49
Alternative Gene Name: FLJ10432
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057788: 90%, ENSRNOG00000022368: 88%
Entrez Gene ID: 54555
Uniprot ID: Q9Y6V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKN
Gene Sequence TLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKN
Gene ID - Mouse ENSMUSG00000057788
Gene ID - Rat ENSRNOG00000022368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX49 pAb (ATL-HPA048093)
Datasheet Anti DDX49 pAb (ATL-HPA048093) Datasheet (External Link)
Vendor Page Anti DDX49 pAb (ATL-HPA048093) at Atlas Antibodies

Documents & Links for Anti DDX49 pAb (ATL-HPA048093)
Datasheet Anti DDX49 pAb (ATL-HPA048093) Datasheet (External Link)
Vendor Page Anti DDX49 pAb (ATL-HPA048093)