Anti DDX27 pAb (ATL-HPA047087)

Atlas Antibodies

SKU:
ATL-HPA047087-25
  • Immunohistochemical staining of human cerebellum shows strong nucleolar and cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
Gene Name: DDX27
Alternative Gene Name: dJ686N3.1, DRS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017999: 73%, ENSRNOG00000008081: 75%
Entrez Gene ID: 55661
Uniprot ID: Q96GQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Gene Sequence EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Gene ID - Mouse ENSMUSG00000017999
Gene ID - Rat ENSRNOG00000008081
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX27 pAb (ATL-HPA047087)
Datasheet Anti DDX27 pAb (ATL-HPA047087) Datasheet (External Link)
Vendor Page Anti DDX27 pAb (ATL-HPA047087) at Atlas Antibodies

Documents & Links for Anti DDX27 pAb (ATL-HPA047087)
Datasheet Anti DDX27 pAb (ATL-HPA047087) Datasheet (External Link)
Vendor Page Anti DDX27 pAb (ATL-HPA047087)



Citations for Anti DDX27 pAb (ATL-HPA047087) – 1 Found
Xiaoqian, Wang; Bing, Zhang; Yangwei, Li; Yafei, Zhi; Tingting, Zhang; Yi, Wang; Qingjun, Li; Suxia, Luo; Ling, Zhang; Bo, Wang; Peng, Zheng. DEAD-box Helicase 27 Promotes Hepatocellular Carcinoma Progression Through ERK Signaling. Technology In Cancer Research & Treatment. 2021;20( 34855554):15330338211055953.  PubMed