Protein Description: D-dopachrome tautomerase
Gene Name: DDT
Alternative Gene Name: DDCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001666: 70%, ENSRNOG00000001239: 72%
Entrez Gene ID: 1652
Uniprot ID: P30046
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDT
Alternative Gene Name: DDCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001666: 70%, ENSRNOG00000001239: 72%
Entrez Gene ID: 1652
Uniprot ID: P30046
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN |
| Documents & Links for Anti DDT pAb (ATL-HPA074115) | |
| Datasheet | Anti DDT pAb (ATL-HPA074115) Datasheet (External Link) |
| Vendor Page | Anti DDT pAb (ATL-HPA074115) at Atlas |
| Documents & Links for Anti DDT pAb (ATL-HPA074115) | |
| Datasheet | Anti DDT pAb (ATL-HPA074115) Datasheet (External Link) |
| Vendor Page | Anti DDT pAb (ATL-HPA074115) |