Anti DDOST pAb (ATL-HPA052867)

Atlas Antibodies

SKU:
ATL-HPA052867-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic)
Gene Name: DDOST
Alternative Gene Name: KIAA0115, OST, OST48, WBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028757: 99%, ENSRNOG00000015079: 99%
Entrez Gene ID: 1650
Uniprot ID: P39656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSL
Gene Sequence LVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSL
Gene ID - Mouse ENSMUSG00000028757
Gene ID - Rat ENSRNOG00000015079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDOST pAb (ATL-HPA052867)
Datasheet Anti DDOST pAb (ATL-HPA052867) Datasheet (External Link)
Vendor Page Anti DDOST pAb (ATL-HPA052867) at Atlas Antibodies

Documents & Links for Anti DDOST pAb (ATL-HPA052867)
Datasheet Anti DDOST pAb (ATL-HPA052867) Datasheet (External Link)
Vendor Page Anti DDOST pAb (ATL-HPA052867)