Anti DDOST pAb (ATL-HPA046841)

Atlas Antibodies

SKU: ATL-HPA046841-25

• 
• 
• 

Protein Description: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic)
Gene Name: DDOST
Alternative Gene Name: KIAA0115, OST, OST48, WBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028757: 97%, ENSRNOG00000015079: 98%
Entrez Gene ID: 1650
Uniprot ID: P39656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQY
• Gene Sequence: NYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQY
• Gene ID - Mouse: ENSMUSG00000028757
• Gene ID - Rat: ENSRNOG00000015079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.