Anti DDI1 pAb (ATL-HPA079511 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA079511-25

• 

Protein Description: DNA damage inducible 1 homolog 1
Gene Name: DDI1
Alternative Gene Name: FLJ36017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047619: 56%, ENSRNOG00000007371: 43%
Entrez Gene ID: 414301
Uniprot ID: Q8WTU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEGELPLCSRMVSGQDESSDKEITHSVMDSGRK
• Gene Sequence: PEGELPLCSRMVSGQDESSDKEITHSVMDSGRK
• Gene ID - Mouse: ENSMUSG00000047619
• Gene ID - Rat: ENSRNOG00000007371
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.